Lineage for d4ozgh1 (4ozg H:3-129)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758331Domain d4ozgh1: 4ozg H:3-129 [257370]
    Other proteins in same PDB: d4ozga1, d4ozga2, d4ozgb1, d4ozgc1, d4ozgc2, d4ozgd1, d4ozge2, d4ozgf2, d4ozgg2, d4ozgh2
    automated match to d3of6c1
    complexed with ca, nag

Details for d4ozgh1

PDB Entry: 4ozg (more details), 3 Å

PDB Description: d2 protein complex
PDB Compounds: (H:) T-cell receptor, d2, beta chain

SCOPe Domain Sequences for d4ozgh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ozgh1 b.1.1.0 (H:3-129) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvsqspsnkvtekgkdvelrcdpisghtalywyrqslgqglefliyfqgnsapdksglps
drfsaertggsvstltiqrtqqedsavylcassfrftdtqyfgpgtrltvled

SCOPe Domain Coordinates for d4ozgh1:

Click to download the PDB-style file with coordinates for d4ozgh1.
(The format of our PDB-style files is described here.)

Timeline for d4ozgh1: