Lineage for d1aipa2 (1aip A:313-405)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1127171Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1127172Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 1127173Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)
  6. 1127201Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 1127233Species Thermus thermophilus [TaxId:274] [50470] (6 PDB entries)
  8. 1127239Domain d1aipa2: 1aip A:313-405 [25737]
    Other proteins in same PDB: d1aipa1, d1aipa3, d1aipb1, d1aipb3, d1aipc1, d1aipc2, d1aipd1, d1aipd2, d1aipe1, d1aipe3, d1aipf1, d1aipf3, d1aipg1, d1aipg2, d1aiph1, d1aiph2

Details for d1aipa2

PDB Entry: 1aip (more details), 3 Å

PDB Description: ef-tu ef-ts complex from thermus thermophilus
PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d1aipa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aipa2 b.44.1.1 (A:313-405) Elongation factor Tu (EF-Tu) {Thermus thermophilus [TaxId: 274]}
htkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile

SCOPe Domain Coordinates for d1aipa2:

Click to download the PDB-style file with coordinates for d1aipa2.
(The format of our PDB-style files is described here.)

Timeline for d1aipa2: