| Class b: All beta proteins [48724] (126 folds) |
| Fold b.44: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50464] (1 superfamily) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) ![]() probably related to the second domain and its superfamiy by a circular permutation |
| Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (3 proteins) |
| Protein Elongation factor Tu (EF-Tu) [50467] (4 species) |
| Species Thermus thermophilus [TaxId:274] [50470] (3 PDB entries) |
| Domain d1aipa2: 1aip A:313-405 [25737] Other proteins in same PDB: d1aipa1, d1aipa3, d1aipb1, d1aipb3, d1aipc1, d1aipc2, d1aipd1, d1aipd2, d1aipe1, d1aipe3, d1aipf1, d1aipf3, d1aipg1, d1aipg2, d1aiph1, d1aiph2 |
PDB Entry: 1aip (more details), 3 Å
SCOP Domain Sequences for d1aipa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aipa2 b.44.1.1 (A:313-405) Elongation factor Tu (EF-Tu) {Thermus thermophilus}
htkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile
Timeline for d1aipa2: