Lineage for d4ozge2 (4ozg E:130-217)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (765 PDB entries)
  8. 2353735Domain d4ozge2: 4ozg E:130-217 [257367]
    Other proteins in same PDB: d4ozga1, d4ozgb1, d4ozgb2, d4ozgc1, d4ozgd1, d4ozgd2, d4ozge1, d4ozgf1, d4ozgg1, d4ozgh1
    automated match to d2pyfa2
    complexed with ca, nag

Details for d4ozge2

PDB Entry: 4ozg (more details), 3 Å

PDB Description: d2 protein complex
PDB Compounds: (E:) T-cell receptor, d2, alpha chain

SCOPe Domain Sequences for d4ozge2:

Sequence, based on SEQRES records: (download)

>d4ozge2 b.1.1.2 (E:130-217) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

Sequence, based on observed residues (ATOM records): (download)

>d4ozge2 b.1.1.2 (E:130-217) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdsdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsava
wsnksdfacanafnnsiipedtffp

SCOPe Domain Coordinates for d4ozge2:

Click to download the PDB-style file with coordinates for d4ozge2.
(The format of our PDB-style files is described here.)

Timeline for d4ozge2: