Lineage for d4ozfh2 (4ozf H:130-256)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1762816Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)
  8. 1763434Domain d4ozfh2: 4ozf H:130-256 [257365]
    Other proteins in same PDB: d4ozfa1, d4ozfb1, d4ozfb2, d4ozfg1, d4ozfh1
    automated match to d3of6b2
    complexed with nag

Details for d4ozfh2

PDB Entry: 4ozf (more details), 2.7 Å

PDB Description: jr5.1 protein complex
PDB Compounds: (H:) T-cell receptor, jr5.1 beta chain

SCOPe Domain Sequences for d4ozfh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ozfh2 b.1.1.2 (H:130-256) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgra

SCOPe Domain Coordinates for d4ozfh2:

Click to download the PDB-style file with coordinates for d4ozfh2.
(The format of our PDB-style files is described here.)

Timeline for d4ozfh2: