SCOPe 2.08: Domain d4ozfh1: 4ozf H:3-129

Lineage for d4ozfh1 (4ozf H:3-129)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4ozfh1: 4ozf H:3-129 [257364]
   Other proteins in same PDB: d4ozfa1, d4ozfa2, d4ozfb1, d4ozfg1, d4ozfg2, d4ozfh2
   automated match to d3of6c1
   complexed with nag

Details for d4ozfh1

PDB Entry: 4ozf, 2.7 Å

PDB Description: jr5.1 protein complex

PDB Compounds: (H:) T-cell receptor, jr5.1 beta chain

SCOPe Domain Sequences for d4ozfh1:

Sequence; same for both SEQRES and ATOM records:

>d4ozfh1 b.1.1.0 (H:3-129) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvsqspsnkvtekgkdvelrcdpisghtalywyrqslgqglefliyfqgnsapdksglps
drfsaertggsvstltiqrtqqedsavylcassfralaadtqyfgpgtrltvled

Timeline for d4ozfh1:

• d4ozfh1 first appeared in SCOPe 2.04
  
• d4ozfh1 appears in SCOPe 2.07