SCOPe 2.07: Domain d4ozfb2: 4ozf B:93-190

Lineage for d4ozfb2 (4ozf B:93-190)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d4ozfb2: 4ozf B:93-190 [257363]
   Other proteins in same PDB: d4ozfa1, d4ozfa2, d4ozfb1, d4ozfg1, d4ozfg2, d4ozfh2
   automated match to d1sebb1
   complexed with nag

Details for d4ozfb2

PDB Entry: 4ozf, 2.7 Å

PDB Description: jr5.1 protein complex

PDB Compounds: (B:) HLA class II histocompatibility antigen, DQ beta 1 chain

SCOPe Domain Sequences for d4ozfb2:

Sequence, based on SEQRES records:

>d4ozfb2 b.1.1.0 (B:93-190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrveptvtispsrtealnhhnllvcsvtdfypaqikvrwfrndqeetagvvstplirngd
wtfqilvmlemtpqrgdvytchvehpslqspitvewra

Sequence, based on observed residues (ATOM records):

>d4ozfb2 b.1.1.0 (B:93-190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrveptvtispshnllvcsvtdfypaqikvrwfrndqeetagvvstplirngdwtfqilv
mlemtpqrgdvytchvehpslqspitvewra

Timeline for d4ozfb2:

• d4ozfb2 first appeared in SCOPe 2.04
  
• d4ozfb2 appears in SCOPe 2.06
  
• d4ozfb2 appears in the current release, SCOPe 2.08