Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d4ozfb2: 4ozf B:93-190 [257363] Other proteins in same PDB: d4ozfa1, d4ozfa2, d4ozfb1, d4ozfg1, d4ozfg2, d4ozfh2 automated match to d1sebb1 complexed with nag |
PDB Entry: 4ozf (more details), 2.7 Å
SCOPe Domain Sequences for d4ozfb2:
Sequence, based on SEQRES records: (download)
>d4ozfb2 b.1.1.0 (B:93-190) automated matches {Human (Homo sapiens) [TaxId: 9606]} rrveptvtispsrtealnhhnllvcsvtdfypaqikvrwfrndqeetagvvstplirngd wtfqilvmlemtpqrgdvytchvehpslqspitvewra
>d4ozfb2 b.1.1.0 (B:93-190) automated matches {Human (Homo sapiens) [TaxId: 9606]} rrveptvtispshnllvcsvtdfypaqikvrwfrndqeetagvvstplirngdwtfqilv mlemtpqrgdvytchvehpslqspitvewra
Timeline for d4ozfb2: