Lineage for d4ozfb1 (4ozf B:3-92)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2507530Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2507531Protein automated matches [226842] (4 species)
    not a true protein
  7. 2507544Species Human (Homo sapiens) [TaxId:9606] [226044] (67 PDB entries)
  8. 2507662Domain d4ozfb1: 4ozf B:3-92 [257362]
    Other proteins in same PDB: d4ozfa2, d4ozfb2, d4ozfg1, d4ozfg2, d4ozfh1, d4ozfh2
    automated match to d1klub2
    complexed with nag

Details for d4ozfb1

PDB Entry: 4ozf (more details), 2.7 Å

PDB Description: jr5.1 protein complex
PDB Compounds: (B:) HLA class II histocompatibility antigen, DQ beta 1 chain

SCOPe Domain Sequences for d4ozfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ozfb1 d.19.1.0 (B:3-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaeywn
sqkdilerkraavdrvcrhnyqlelrttlq

SCOPe Domain Coordinates for d4ozfb1:

Click to download the PDB-style file with coordinates for d4ozfb1.
(The format of our PDB-style files is described here.)

Timeline for d4ozfb1: