Lineage for d4ozfa1 (4ozf A:1-81)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938673Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)
  8. 2938830Domain d4ozfa1: 4ozf A:1-81 [257360]
    Other proteins in same PDB: d4ozfa2, d4ozfb2, d4ozfg1, d4ozfg2, d4ozfh1, d4ozfh2
    automated match to d1uvqa2
    complexed with nag

Details for d4ozfa1

PDB Entry: 4ozf (more details), 2.7 Å

PDB Description: jr5.1 protein complex
PDB Compounds: (A:) HLA class II histocompatibility antigen, DQ alpha 1 chain

SCOPe Domain Sequences for d4ozfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ozfa1 d.19.1.0 (A:1-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqfal
tniavlkhnlnslikrsnsta

SCOPe Domain Coordinates for d4ozfa1:

Click to download the PDB-style file with coordinates for d4ozfa1.
(The format of our PDB-style files is described here.)

Timeline for d4ozfa1: