Lineage for d1exma2 (1exm A:313-405)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14748Fold b.44: EF-Tu/eEF-1alpha C-terminal domain [50464] (1 superfamily)
  4. 14749Superfamily b.44.1: EF-Tu/eEF-1alpha C-terminal domain [50465] (1 family) (S)
  5. 14750Family b.44.1.1: EF-Tu/eEF-1alpha C-terminal domain [50466] (2 proteins)
  6. 14755Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 14779Species Thermus thermophilus [TaxId:274] [50470] (2 PDB entries)
  8. 14780Domain d1exma2: 1exm A:313-405 [25736]
    Other proteins in same PDB: d1exma1, d1exma3

Details for d1exma2

PDB Entry: 1exm (more details), 1.7 Å

PDB Description: crystal structure of thermus thermophilus elongation factor tu (ef-tu) in complex with the gtp analogue gppnhp.

SCOP Domain Sequences for d1exma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1exma2 b.44.1.1 (A:313-405) Elongation factor Tu (EF-Tu) {Thermus thermophilus}
htkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile

SCOP Domain Coordinates for d1exma2:

Click to download the PDB-style file with coordinates for d1exma2.
(The format of our PDB-style files is described here.)

Timeline for d1exma2: