![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) ![]() probably related to the second domain and its superfamiy by a circular permutation |
![]() | Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins) |
![]() | Protein Elongation factor Tu (EF-Tu) [50467] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [50470] (4 PDB entries) |
![]() | Domain d1exma2: 1exm A:313-405 [25736] Other proteins in same PDB: d1exma1, d1exma3 protein/RNA complex; complexed with gnp, mg |
PDB Entry: 1exm (more details), 1.7 Å
SCOPe Domain Sequences for d1exma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1exma2 b.44.1.1 (A:313-405) Elongation factor Tu (EF-Tu) {Thermus thermophilus [TaxId: 274]} htkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftv elikpvaleeglrfaireggrtvgagvvtkile
Timeline for d1exma2: