Lineage for d4oz6a_ (4oz6 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2083931Fold b.86: Hedgehog/intein (Hint) domain [51293] (1 superfamily)
    complex fold made of five beta-hairpin units and a b-ribbon arc
  4. 2083932Superfamily b.86.1: Hedgehog/intein (Hint) domain [51294] (3 families) (S)
    duplication: contains two intertwined structural repeats
  5. 2083937Family b.86.1.2: Intein (protein splicing domain) [51298] (5 proteins)
  6. 2083961Protein automated matches [237863] (2 species)
    not a true protein
  7. 2083962Species Mycobacterium xenopi [TaxId:1789] [257356] (1 PDB entry)
  8. 2083963Domain d4oz6a_: 4oz6 A: [257357]
    automated match to d1am2a_
    complexed with mg

Details for d4oz6a_

PDB Entry: 4oz6 (more details), 2.79 Å

PDB Description: structure of the branched intermediate in protein splicing
PDB Compounds: (A:) mxe gyra intein

SCOPe Domain Sequences for d4oz6a_:

Sequence, based on SEQRES records: (download)

>d4oz6a_ b.86.1.2 (A:) automated matches {Mycobacterium xenopi [TaxId: 1789]}
aitgdalvalpegesvriadivpgarpnsdnaidlkvldrhgnpvladrlfhsgehpvyt
vrtveglrvtgtanhpllclvdvagvptllwklideikpgdyaviqrsafsvdcagfarg
kpefapttytvgvpglvrfleahhrdpdaqaiadeltdgrfyyakvasvtdagvqpvysl
rvdacdaafitngfvshnteap

Sequence, based on observed residues (ATOM records): (download)

>d4oz6a_ b.86.1.2 (A:) automated matches {Mycobacterium xenopi [TaxId: 1789]}
aitgdalvalpegesvriadivpgarpnsdnaidlkvldrhgnpvladrlfhsgehpvyt
vrtveglrvtgtanhpllclvdvagvptllwklideikpgdyaviqrsafvpglvrflaq
aiadeltdgrfyyakvasvtdagvqpvyslrvdacdaafitngfvshnteap

SCOPe Domain Coordinates for d4oz6a_:

Click to download the PDB-style file with coordinates for d4oz6a_.
(The format of our PDB-style files is described here.)

Timeline for d4oz6a_: