Lineage for d4oyla_ (4oyl A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1615834Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1615835Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1617684Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1617685Protein automated matches [190543] (56 species)
    not a true protein
  7. 1617906Species Humicola insolens [TaxId:34413] [257354] (2 PDB entries)
  8. 1617907Domain d4oyla_: 4oyl A: [257355]
    automated match to d3dd5a_

Details for d4oyla_

PDB Entry: 4oyl (more details), 2.05 Å

PDB Description: humicola insolens cutinase in complex with mono-ethylphosphate
PDB Compounds: (A:) cutinase

SCOPe Domain Sequences for d4oyla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oyla_ c.69.1.0 (A:) automated matches {Humicola insolens [TaxId: 34413]}
gaienglesgsanacpdailifargstepgnmgitvgpalangleshirniwiqgvggpy
daalatnflprgtsqanidegkrlfalanqkcpntpvvaggyxqgaaliaaavselsgav
keqvkgvalfgytqnlqnrggipnyprertkvfcnvgdavctgtliitpaxlsytiearg
eaarflrdrir

SCOPe Domain Coordinates for d4oyla_:

Click to download the PDB-style file with coordinates for d4oyla_.
(The format of our PDB-style files is described here.)

Timeline for d4oyla_: