SCOPe 2.06: Domain d4oxxa_: 4oxx A:

Lineage for d4oxxa_ (4oxx A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.0: automated matches [191330] (1 protein)
   not a true family

6. Protein automated matches [190158] (24 species)
   not a true protein

7. Species Citrobacter braakii [TaxId:57706] [257348] (1 PDB entry)

8. Domain d4oxxa_: 4oxx A: [257349]
   automated match to d1ykga1
   complexed with fmn; mutant

Details for d4oxxa_

PDB Entry: 4oxx, 1.21 Å

PDB Description: crystal structure of cindoxin, surface entropy reduction mutant

PDB Compounds: (A:) Cindoxin

SCOPe Domain Sequences for d4oxxa_:

Sequence; same for both SEQRES and ATOM records:

>d4oxxa_ c.23.5.0 (A:) automated matches {Citrobacter braakii [TaxId: 57706]}
mnalilygtetgnaeacattisqvladtvdtkvhdladmtpramldsgadlivfatatyg
egefagggaaffetlretkpdlsglrfavfglgdsyyttfnqagataatilaslggtqvg
dtarhdtssgddpaataaewareiltalatpav

Timeline for d4oxxa_:

• d4oxxa_ first appeared in SCOPe 2.04
  
• d4oxxa_ appears in SCOPe 2.05
  
• d4oxxa_ appears in SCOPe 2.07
  
• d4oxxa_ appears in the current release, SCOPe 2.08