Lineage for d4oxxa_ (4oxx A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2115525Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2116045Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2116046Protein automated matches [190158] (24 species)
    not a true protein
  7. 2116057Species Citrobacter braakii [TaxId:57706] [257348] (1 PDB entry)
  8. 2116058Domain d4oxxa_: 4oxx A: [257349]
    automated match to d1ykga1
    complexed with fmn; mutant

Details for d4oxxa_

PDB Entry: 4oxx (more details), 1.21 Å

PDB Description: crystal structure of cindoxin, surface entropy reduction mutant
PDB Compounds: (A:) Cindoxin

SCOPe Domain Sequences for d4oxxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oxxa_ c.23.5.0 (A:) automated matches {Citrobacter braakii [TaxId: 57706]}
mnalilygtetgnaeacattisqvladtvdtkvhdladmtpramldsgadlivfatatyg
egefagggaaffetlretkpdlsglrfavfglgdsyyttfnqagataatilaslggtqvg
dtarhdtssgddpaataaewareiltalatpav

SCOPe Domain Coordinates for d4oxxa_:

Click to download the PDB-style file with coordinates for d4oxxa_.
(The format of our PDB-style files is described here.)

Timeline for d4oxxa_: