Lineage for d4ox2b2 (4ox2 B:260-622)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1623982Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 1623983Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) (S)
  5. 1623984Family c.91.1.1: PEP carboxykinase C-terminal domain [53796] (3 proteins)
  6. 1624057Protein automated matches [257345] (1 species)
    not a true protein
  7. 1624058Species Rattus norvegicus [TaxId:10116] [257346] (1 PDB entry)
  8. 1624060Domain d4ox2b2: 4ox2 B:260-622 [257347]
    Other proteins in same PDB: d4ox2b1
    automated match to d3dtba2
    complexed with 1pe, etx, gtp, mn, na, spv

Details for d4ox2b2

PDB Entry: 4ox2 (more details), 2 Å

PDB Description: i45t cytosolic phosphoenolpyruvate carboxykinase in complex with beta- sulfopyruvate and gtp
PDB Compounds: (B:) Phosphoenolpyruvate carboxykinase, cytosolic [GTP]

SCOPe Domain Sequences for d4ox2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ox2b2 c.91.1.1 (B:260-622) automated matches {Rattus norvegicus [TaxId: 10116]}
wlaehmlilgitnpegkkkylaaafpsacgktnlammnptlpgwkvecvgddiawmkfda
qgnlrainpengffgvapgtsvktnpnaiktiqkntiftnvaetsdggvywegideplap
gvtitswknkewrpqdeepcahpnsrfctpasqcpiidpawespegvpiegiifggrrpa
gvplvyealswqhgvfvgaamrseataaaehkgkvimhdpfamrpffgynfgkylahwls
mahrpaaklpkifhvnwfrkdkngkflwpgfgensrvlewmfgriegedsakltpigyvp
kedalnlkglgdvnveelfgiskefwekeveeidkyledqvnadlpyeierelralkqri
sqm

SCOPe Domain Coordinates for d4ox2b2:

Click to download the PDB-style file with coordinates for d4ox2b2.
(The format of our PDB-style files is described here.)

Timeline for d4ox2b2: