Lineage for d4ox2b1 (4ox2 B:3-259)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2168058Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2168059Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2168060Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins)
  6. 2168151Protein automated matches [257342] (1 species)
    not a true protein
  7. 2168152Species Norway rat (Rattus norvegicus) [TaxId:10116] [257343] (1 PDB entry)
  8. 2168154Domain d4ox2b1: 4ox2 B:3-259 [257344]
    Other proteins in same PDB: d4ox2a2, d4ox2b2
    automated match to d3dt2a1
    complexed with 1pe, etx, gtp, mn, na, spv

Details for d4ox2b1

PDB Entry: 4ox2 (more details), 2 Å

PDB Description: i45t cytosolic phosphoenolpyruvate carboxykinase in complex with beta- sulfopyruvate and gtp
PDB Compounds: (B:) Phosphoenolpyruvate carboxykinase, cytosolic [GTP]

SCOPe Domain Sequences for d4ox2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ox2b1 c.109.1.1 (B:3-259) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pqlhngldfsakviqgsldslpqevrkfvegnaqlcqpeyihtcdgseeeygrllahmqe
egvirklkkydncwlaltdprdvariesktviitqeqrdtvpipksgqsqlgrwmseedf
ekafnarfpgcmkgrtmyvipfsmgplgsplakigieltdspyvvasmrimtrmgtsvle
algdgefikclhsvgcplplkkplvnnwacnpeltliahlpdrreiisfgsgyggnsllg
kkcfalriasrlakeeg

SCOPe Domain Coordinates for d4ox2b1:

Click to download the PDB-style file with coordinates for d4ox2b1.
(The format of our PDB-style files is described here.)

Timeline for d4ox2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ox2b2