Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily) contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain |
Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) |
Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins) |
Protein automated matches [257342] (1 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [257343] (1 PDB entry) |
Domain d4ox2b1: 4ox2 B:3-259 [257344] Other proteins in same PDB: d4ox2a2, d4ox2b2 automated match to d3dt2a1 complexed with 1pe, etx, gtp, mn, na, spv |
PDB Entry: 4ox2 (more details), 2 Å
SCOPe Domain Sequences for d4ox2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ox2b1 c.109.1.1 (B:3-259) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} pqlhngldfsakviqgsldslpqevrkfvegnaqlcqpeyihtcdgseeeygrllahmqe egvirklkkydncwlaltdprdvariesktviitqeqrdtvpipksgqsqlgrwmseedf ekafnarfpgcmkgrtmyvipfsmgplgsplakigieltdspyvvasmrimtrmgtsvle algdgefikclhsvgcplplkkplvnnwacnpeltliahlpdrreiisfgsgyggnsllg kkcfalriasrlakeeg
Timeline for d4ox2b1: