![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
![]() | Family d.2.1.0: automated matches [191411] (1 protein) not a true family |
![]() | Protein automated matches [190563] (18 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [236519] (2 PDB entries) |
![]() | Domain d4ow1a_: 4ow1 A: [257338] automated match to d4emna_ complexed with edo |
PDB Entry: 4ow1 (more details), 1.9 Å
SCOPe Domain Sequences for d4ow1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ow1a_ d.2.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} gpspnwdavaqcesggnwaantgngkygglqfkpatwaafggvgnpaaasreqqiavanr vlaeqgldawptcgaasglpialwsk
Timeline for d4ow1a_: