SCOPe 2.06: Domain d4ovia2: 4ovi A:155-389

Lineage for d4ovia2 (4ovi A:155-389)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein Phenylacetone monooxygenase [110440] (1 species)

7. Species Thermobifida fusca [TaxId:2021] [110441] (6 PDB entries)
   Uniprot Q5YS95 # 55% sequence identity; Nocardia farcinica TaxID:37329

8. Domain d4ovia2: 4ovi A:155-389 [257337]
   automated match to d1w4xa2
   complexed with act, cl, fad, gol, n01, pge

Details for d4ovia2

PDB Entry: 4ovi, 1.87 Å

PDB Description: Phenylacetone monooxygenase: oxidised enzyme in complex with APADP

PDB Compounds: (A:) phenylacetone monooxygenase

SCOPe Domain Sequences for d4ovia2:

Sequence; same for both SEQRES and ATOM records:

>d4ovia2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]}
vpqlpnfpglkdfagnlyhtgnwphepvdfsgqrvgvigtgssgiqvspqiakqaaelfv
fqrtphfavparnapldpefladlkkryaefreesrntpggthryqgpksalevsdeelv
etlerywqeggpdilaayrdilrdrdanervaefirnkirntvrdpevaerlvpkgypfg
tkrlileidyyemfnrdnvhlvdtlsapietitprgvrtsereyeldslvlatgf

Timeline for d4ovia2:

• d4ovia2 first appeared in SCOPe 2.04
  
• d4ovia2 appears in SCOPe 2.05
  
• d4ovia2 appears in SCOPe 2.07
  
• d4ovia2 appears in the current release, SCOPe 2.08