Lineage for d4otqa_ (4otq A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1673984Protein automated matches [190091] (13 species)
    not a true protein
  7. 1674055Species Human (Homo sapiens) [TaxId:9606] [188447] (490 PDB entries)
  8. 1674084Domain d4otqa_: 4otq A: [257335]
    automated match to d3pj2a_
    complexed with 2v2, dms

Details for d4otqa_

PDB Entry: 4otq (more details), 1.55 Å

PDB Description: crystal structure of btk kinase domain complexed with 1-[5-[3-(7-tert- butyl-4-oxo-quinazolin-3-yl)-2-methyl-phenyl]-1-methyl-2-oxo-3- pyridyl]-3-methyl-urea
PDB Compounds: (A:) Tyrosine-protein kinase BTK

SCOPe Domain Sequences for d4otqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4otqa_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnlshe
klvqlygvctkqrpifiiteymangcllnylrearhafqtqqllemckdvceameylesk
qflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmyskfs
sksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasaavytimyscwh
ekaderptfkillsnildvmdee

SCOPe Domain Coordinates for d4otqa_:

Click to download the PDB-style file with coordinates for d4otqa_.
(The format of our PDB-style files is described here.)

Timeline for d4otqa_: