Lineage for d4ouja2 (4ouj A:154-294)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1790651Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1791069Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 1791277Family b.42.2.0: automated matches [227190] (1 protein)
    not a true family
  6. 1791278Protein automated matches [226913] (8 species)
    not a true protein
  7. 1791319Species Clostridium botulinum [TaxId:498213] [257331] (1 PDB entry)
  8. 1791321Domain d4ouja2: 4ouj A:154-294 [257333]
    automated match to d4lo0a2
    complexed with lbt

Details for d4ouja2

PDB Entry: 4ouj (more details), 1.46 Å

PDB Description: crystal structure of ha33b-lac
PDB Compounds: (A:) Hemagglutinin component HA33

SCOPe Domain Sequences for d4ouja2:

Sequence, based on SEQRES records: (download)

>d4ouja2 b.42.2.0 (A:154-294) automated matches {Clostridium botulinum [TaxId: 498213]}
nftcrispilaggkvvqqvsmtnlavnlyiwnndlnqkwtiiyneekaayqffnkilsng
vltwifsdgntvrvsssaqnndaqywlinpvsdnydrytitnlrdktkvldlyggqtadg
ttiqvfnsnggdnqkwnirnp

Sequence, based on observed residues (ATOM records): (download)

>d4ouja2 b.42.2.0 (A:154-294) automated matches {Clostridium botulinum [TaxId: 498213]}
nftcrispilaggkvvqqvsmtnlavnlyiwnndlnqkwtiiyneekaayqffnkilsng
vltwifsdgntvrvsssaqnndaqywlinpvsdrytitnlrdktkvldlyggqtadgtti
qvfnsnggdnqkwnirnp

SCOPe Domain Coordinates for d4ouja2:

Click to download the PDB-style file with coordinates for d4ouja2.
(The format of our PDB-style files is described here.)

Timeline for d4ouja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ouja1