![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.16: C-terminal domain of RPA32 [46844] (2 proteins) |
![]() | Protein automated matches [257328] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [257329] (1 PDB entry) |
![]() | Domain d4ou0a_: 4ou0 A: [257330] automated match to d1dpua_ |
PDB Entry: 4ou0 (more details), 1.4 Å
SCOPe Domain Sequences for d4ou0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ou0a_ a.4.5.16 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ngltvaqnqvlnlikacprpeglnfqdlknqlkhmsvssikqavdflsneghiystvddd hfkstd
Timeline for d4ou0a_: