Lineage for d4ou0a_ (4ou0 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693347Family a.4.5.16: C-terminal domain of RPA32 [46844] (2 proteins)
  6. 2693352Protein automated matches [257328] (1 species)
    not a true protein
  7. 2693353Species Human (Homo sapiens) [TaxId:9606] [257329] (1 PDB entry)
  8. 2693354Domain d4ou0a_: 4ou0 A: [257330]
    automated match to d1dpua_

Details for d4ou0a_

PDB Entry: 4ou0 (more details), 1.4 Å

PDB Description: crystal structure of rpa32c
PDB Compounds: (A:) Replication protein A 32 kDa subunit

SCOPe Domain Sequences for d4ou0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ou0a_ a.4.5.16 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ngltvaqnqvlnlikacprpeglnfqdlknqlkhmsvssikqavdflsneghiystvddd
hfkstd

SCOPe Domain Coordinates for d4ou0a_:

Click to download the PDB-style file with coordinates for d4ou0a_.
(The format of our PDB-style files is described here.)

Timeline for d4ou0a_: