Lineage for d1tuia2 (1tui A:314-405)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 375902Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 375903Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 375904Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (3 proteins)
  6. 375914Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 375929Species Thermus aquaticus [TaxId:271] [50469] (4 PDB entries)
  8. 375935Domain d1tuia2: 1tui A:314-405 [25733]
    Other proteins in same PDB: d1tuia1, d1tuia3, d1tuib1, d1tuib3, d1tuic1, d1tuic3

Details for d1tuia2

PDB Entry: 1tui (more details), 2.7 Å

PDB Description: intact elongation factor tu in complex with gdp

SCOP Domain Sequences for d1tuia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tuia2 b.44.1.1 (A:314-405) Elongation factor Tu (EF-Tu) {Thermus aquaticus}
tkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpgdnvtftve
likpvaleeglrfaireggrtvgagvvtkile

SCOP Domain Coordinates for d1tuia2:

Click to download the PDB-style file with coordinates for d1tuia2.
(The format of our PDB-style files is described here.)

Timeline for d1tuia2: