SCOPe 2.04: Domain d4ot2a1: 4ot2 A:4-195

Lineage for d4ot2a1 (4ot2 A:4-195)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.0: automated matches [254216] (1 protein)
   not a true family

6. Protein automated matches [254493] (5 species)
   not a true protein

7. Species Horse (Equus caballus) [TaxId:9796] [256129] (5 PDB entries)

8. Domain d4ot2a1: 4ot2 A:4-195 [257321]
   automated match to d1hk5a2
   complexed with act, mli, nps, sin

Details for d4ot2a1

PDB Entry: 4ot2, 2.42 Å

PDB Description: Crystal Structure of Equine Serum Albumin in complex with Naproxen

PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d4ot2a1:

Sequence; same for both SEQRES and ATOM records:

>d4ot2a1 a.126.1.0 (A:4-195) automated matches {Horse (Equus caballus) [TaxId: 9796]}
kseiahrfndlgekhfkglvlvafsqylqqcpfedhvklvnevtefakkcaadesaencd
kslhtlfgdklctvatlratygeladccekqepernecflthkddhpnlpklkpepdaqc
aafqedpdkflgkylyevarrhpyfygpellfhaeeykadfteccpaddklaclipklda
lkerillssake

Timeline for d4ot2a1:

• d4ot2a1 is new in SCOPe 2.04-stable
  
• d4ot2a1 appears in SCOPe 2.05
  
• d4ot2a1 appears in the current release, SCOPe 2.08