SCOPe 2.05: Domain d4or5f_: 4or5 F:

Lineage for d4or5f_ (4or5 F:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (553 PDB entries)

8. Domain d4or5f_: 4or5 F: [257319]
   Other proteins in same PDB: d4or5b1, d4or5b2, d4or5g1, d4or5g2
   automated match to d3miaa_
   protein/RNA complex; complexed with so4, yt3, zn

Details for d4or5f_

PDB Entry: 4or5, 2.9 Å

PDB Description: Crystal structure of HIV-1 Tat complexed with human P-TEFb and AFF4

PDB Compounds: (F:) Cyclin-dependent kinase 9

SCOPe Domain Sequences for d4or5f_:

Sequence; same for both SEQRES and ATOM records:

>d4or5f_ d.144.1.7 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalrei
kilqllkhenvvnlieicrtkaspynrckgsiylvfdfcehdlagllsnvlvkftlseik
rvmqmllnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslaknsqpnrytn
rvvtlwyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgs
itpevwpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsd
dalnhdffwsdpmpsdlkgmlsthl

Timeline for d4or5f_:

• d4or5f_ first appeared in SCOPe 2.04
  
• d4or5f_ appears in SCOPe 2.06
  
• d4or5f_ appears in the current release, SCOPe 2.08