Lineage for d4or5f_ (4or5 F:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1673984Protein automated matches [190091] (13 species)
    not a true protein
  7. 1674055Species Human (Homo sapiens) [TaxId:9606] [188447] (490 PDB entries)
  8. 1674735Domain d4or5f_: 4or5 F: [257319]
    Other proteins in same PDB: d4or5b1, d4or5b2
    automated match to d3miaa_
    protein/RNA complex; complexed with so4, yt3, zn

Details for d4or5f_

PDB Entry: 4or5 (more details), 2.9 Å

PDB Description: Crystal structure of HIV-1 Tat complexed with human P-TEFb and AFF4
PDB Compounds: (F:) Cyclin-dependent kinase 9

SCOPe Domain Sequences for d4or5f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4or5f_ d.144.1.7 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalrei
kilqllkhenvvnlieicrtkaspynrckgsiylvfdfcehdlagllsnvlvkftlseik
rvmqmllnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslaknsqpnrytn
rvvtlwyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgs
itpevwpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsd
dalnhdffwsdpmpsdlkgmlsthl

SCOPe Domain Coordinates for d4or5f_:

Click to download the PDB-style file with coordinates for d4or5f_.
(The format of our PDB-style files is described here.)

Timeline for d4or5f_: