SCOPe 2.07: Domain d4or0a2: 4or0 A:196-387

Lineage for d4or0a2 (4or0 A:196-387)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.0: automated matches [254216] (1 protein)
   not a true family

6. Protein automated matches [254493] (6 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [256128] (5 PDB entries)

8. Domain d4or0a2: 4or0 A:196-387 [257315]
   automated match to d3uiva1
   complexed with nps, peg, pge

Details for d4or0a2

PDB Entry: 4or0, 2.58 Å

PDB Description: Crystal Structure of Bovine Serum Albumin in complex with naproxen

PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d4or0a2:

Sequence; same for both SEQRES and ATOM records:

>d4or0a2 a.126.1.0 (A:196-387) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rlrcasiqkfgeralkawsvarlsqkfpkaefvevtklvtdltkvhkecchgdllecadd
radlakyicdnqdtissklkeccdkpllekshciaevekdaipenlppltadfaedkdvc
knyqeakdaflgsflyeysrrhpeyavsvllrlakeyeatleeccakddphacystvfdk
lkhlvdepqnli

Timeline for d4or0a2:

• d4or0a2 first appeared in SCOPe 2.04
  
• d4or0a2 appears in SCOPe 2.06
  
• d4or0a2 appears in the current release, SCOPe 2.08