SCOPe 2.04: Domain d4oqpa_: 4oqp A:

Lineage for d4oqpa_ (4oqp A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families)

5. Family c.124.1.0: automated matches [191609] (1 protein)
   not a true family

6. Protein automated matches [191112] (10 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [257310] (2 PDB entries)

8. Domain d4oqpa_: 4oqp A: [257311]
   automated match to d3nzeb_
   complexed with cd, co, mg, ni, ped

Details for d4oqpa_

PDB Entry: 4oqp, 1.6 Å

PDB Description: structure of the effector-binding domain of deoxyribonucleoside regulator deor from bacillus subtilis in complex with deoxyribose-5- phosphate

PDB Compounds: (A:) Deoxyribonucleoside regulator

SCOPe Domain Sequences for d4oqpa_:

Sequence; same for both SEQRES and ATOM records:

>d4oqpa_ c.124.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
fedldalgsileekyglleahvvfsptpdyagithdlsrygaeymhetvkdgdivgvswg
ttmyqiaqnmqpkqvkgvevvqlkggishsrvntysaetiqlfaeafqtmprylplpvvf
dnadvkrmvekdrhieriiemgkqanialftvgtvrdeallfrlgyfneeekallkkqav
gdicsrffdakgnicssaindrtigvelqdlrlkersilvaggsrkvssihgaltgkyan
vliidqhtaralvn

Timeline for d4oqpa_:

• d4oqpa_ is new in SCOPe 2.04-stable
  
• d4oqpa_ appears in SCOPe 2.05
  
• d4oqpa_ appears in the current release, SCOPe 2.08