Lineage for d4oqpa_ (4oqp A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1630703Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 1630704Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 1630981Family c.124.1.0: automated matches [191609] (1 protein)
    not a true family
  6. 1630982Protein automated matches [191112] (10 species)
    not a true protein
  7. 1631038Species Bacillus subtilis [TaxId:224308] [257310] (2 PDB entries)
  8. 1631039Domain d4oqpa_: 4oqp A: [257311]
    automated match to d3nzeb_
    complexed with cd, co, mg, ni, ped

Details for d4oqpa_

PDB Entry: 4oqp (more details), 1.6 Å

PDB Description: structure of the effector-binding domain of deoxyribonucleoside regulator deor from bacillus subtilis in complex with deoxyribose-5- phosphate
PDB Compounds: (A:) Deoxyribonucleoside regulator

SCOPe Domain Sequences for d4oqpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oqpa_ c.124.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
fedldalgsileekyglleahvvfsptpdyagithdlsrygaeymhetvkdgdivgvswg
ttmyqiaqnmqpkqvkgvevvqlkggishsrvntysaetiqlfaeafqtmprylplpvvf
dnadvkrmvekdrhieriiemgkqanialftvgtvrdeallfrlgyfneeekallkkqav
gdicsrffdakgnicssaindrtigvelqdlrlkersilvaggsrkvssihgaltgkyan
vliidqhtaralvn

SCOPe Domain Coordinates for d4oqpa_:

Click to download the PDB-style file with coordinates for d4oqpa_.
(The format of our PDB-style files is described here.)

Timeline for d4oqpa_: