Lineage for d1b23p2 (1b23 P:313-405)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 561274Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 561275Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 561276Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (5 proteins)
  6. 561302Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 561319Species Thermus aquaticus [TaxId:271] [50469] (4 PDB entries)
  8. 561320Domain d1b23p2: 1b23 P:313-405 [25729]
    Other proteins in same PDB: d1b23p1, d1b23p3
    complexed with aac, gnp, h2u, mg, mia, psu, s4u, so4

Details for d1b23p2

PDB Entry: 1b23 (more details), 2.6 Å

PDB Description: e. coli cysteinyl-trna and t. aquaticus elongation factor ef-tu:gtp ternary complex

SCOP Domain Sequences for d1b23p2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b23p2 b.44.1.1 (P:313-405) Elongation factor Tu (EF-Tu) {Thermus aquaticus}
htkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile

SCOP Domain Coordinates for d1b23p2:

Click to download the PDB-style file with coordinates for d1b23p2.
(The format of our PDB-style files is described here.)

Timeline for d1b23p2: