Lineage for d4olta_ (4olt A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2926431Family d.2.1.7: Chitosanase [53996] (2 proteins)
    automatically mapped to Pfam PF01374
  6. 2926440Protein automated matches [230243] (3 species)
    not a true protein
  7. 2926444Species Pseudomonas sp. [TaxId:878476] [257287] (1 PDB entry)
  8. 2926445Domain d4olta_: 4olt A: [257288]
    automated match to d1chka_
    complexed with gol

Details for d4olta_

PDB Entry: 4olt (more details), 1.59 Å

PDB Description: chitosanase complex structure
PDB Compounds: (A:) Chitosanase

SCOPe Domain Sequences for d4olta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4olta_ d.2.1.7 (A:) automated matches {Pseudomonas sp. [TaxId: 878476]}
tvdldapvqkdtamslvssfensstdwqaqygylediadgrgytggligftsgtgdmlel
vraysasspgnpleqyipaleavngtdshaglgqgfeqawadaaetsefraaqdaerdrv
yfdpavaqgkadglsalgqfayydtlvvhgpgsqrdafggiraealsaalppsqggdete
yleaffdarnvimreepahadtsridtaqrvflqngnfdlerpltwsvygdqysln

SCOPe Domain Coordinates for d4olta_:

Click to download the PDB-style file with coordinates for d4olta_.
(The format of our PDB-style files is described here.)

Timeline for d4olta_: