SCOPe 2.08: Domain d4okvb2: 4okv B:113-218

Lineage for d4okvb2 (4okv B:113-218)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4okvb2: 4okv B:113-218 [257282]
   Other proteins in same PDB: d4okva1, d4okva2, d4okvb1, d4okvc1, d4okvc2, d4okvd1
   automated match to d1f3dj2

Details for d4okvb2

PDB Entry: 4okv, 1.8 Å

PDB Description: Crystal structure of anopheline anti-platelet protein with Fab antibody

PDB Compounds: (B:) light chain of 8H7 mAb

SCOPe Domain Sequences for d4okvb2:

Sequence; same for both SEQRES and ATOM records:

>d4okvb2 b.1.1.2 (B:113-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrna

Timeline for d4okvb2:

• d4okvb2 first appeared in SCOPe 2.04
  
• d4okvb2 appears in SCOPe 2.07