| Class b: All beta proteins [48724] (174 folds) |
| Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) ![]() probably related to the second domain and its superfamiy by a circular permutation |
| Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins) |
| Protein Elongation factor Tu (EF-Tu) [50467] (4 species) |
| Species Thermus aquaticus [TaxId:271] [50469] (5 PDB entries) |
| Domain d1efta2: 1eft A:313-405 [25728] Other proteins in same PDB: d1efta1, d1efta3 complexed with gnp, mg |
PDB Entry: 1eft (more details), 2.5 Å
SCOPe Domain Sequences for d1efta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efta2 b.44.1.1 (A:313-405) Elongation factor Tu (EF-Tu) {Thermus aquaticus [TaxId: 271]}
htkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvrlpqgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile
Timeline for d1efta2: