SCOPe 2.08: Domain d4okha1: 4okh A:651-821

Lineage for d4okha1 (4okh A:651-821)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (36 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189519] (58 PDB entries)

8. Domain d4okha1: 4okh A:651-821 [257278]
   Other proteins in same PDB: d4okha2, d4okhb2
   automated match to d1kfxs_
   complexed with ca, peu

Details for d4okha1

PDB Entry: 4okh, 2.45 Å

PDB Description: crystal structure of calpain-3 penta-ef-hand domain

PDB Compounds: (A:) Calpain-3

SCOPe Domain Sequences for d4okha1:

Sequence, based on SEQRES records:

>d4okha1 a.39.1.0 (A:651-821) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qqqfrnifkqiagddmeicadelkkvlntvvnkhkdlkthgftlescrsmialmdtdgsg
klnlqefhhlwnkikawqkifkhydtdqsgtinsyemrnavndagfhlnnqlydiitmry
adkhmnidfdsficcfvrlegmfrafhafdkdgdgiiklnvlewlqltmya

Sequence, based on observed residues (ATOM records):

>d4okha1 a.39.1.0 (A:651-821) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qqqfrnifkqiagddmeicadelkkvlntvvnkthgftlescrsmialmdtdgsgklnlq
efhhlwnkikawqkifkhydtdqsgtinsyemrnavndagfhlnnqlydiitmryadkhm
nidfdsficcfvrlegmfrafhafdkdgdgiiklnvlewlqltmya

Timeline for d4okha1:

• d4okha1 first appeared in SCOPe 2.04, called d4okha_
  
• d4okha1 appears in SCOPe 2.07