Lineage for d4okha1 (4okh A:651-821)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711591Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2711592Protein automated matches [190513] (36 species)
    not a true protein
  7. 2711650Species Human (Homo sapiens) [TaxId:9606] [189519] (58 PDB entries)
  8. 2711696Domain d4okha1: 4okh A:651-821 [257278]
    Other proteins in same PDB: d4okha2, d4okhb2
    automated match to d1kfxs_
    complexed with ca, peu

Details for d4okha1

PDB Entry: 4okh (more details), 2.45 Å

PDB Description: crystal structure of calpain-3 penta-ef-hand domain
PDB Compounds: (A:) Calpain-3

SCOPe Domain Sequences for d4okha1:

Sequence, based on SEQRES records: (download)

>d4okha1 a.39.1.0 (A:651-821) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qqqfrnifkqiagddmeicadelkkvlntvvnkhkdlkthgftlescrsmialmdtdgsg
klnlqefhhlwnkikawqkifkhydtdqsgtinsyemrnavndagfhlnnqlydiitmry
adkhmnidfdsficcfvrlegmfrafhafdkdgdgiiklnvlewlqltmya

Sequence, based on observed residues (ATOM records): (download)

>d4okha1 a.39.1.0 (A:651-821) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qqqfrnifkqiagddmeicadelkkvlntvvnkthgftlescrsmialmdtdgsgklnlq
efhhlwnkikawqkifkhydtdqsgtinsyemrnavndagfhlnnqlydiitmryadkhm
nidfdsficcfvrlegmfrafhafdkdgdgiiklnvlewlqltmya

SCOPe Domain Coordinates for d4okha1:

Click to download the PDB-style file with coordinates for d4okha1.
(The format of our PDB-style files is described here.)

Timeline for d4okha1: