Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families) |
Family d.58.10.0: automated matches [191394] (1 protein) not a true family |
Protein automated matches [190511] (7 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:2287] [187465] (8 PDB entries) |
Domain d4ojha_: 4ojh A: [257275] automated match to d1y9oa_ complexed with so4; mutant |
PDB Entry: 4ojh (more details), 1.6 Å
SCOPe Domain Sequences for d4ojha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ojha_ d.58.10.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 2287]} mlkrmyarvyglvqgvgfrkfvqihairlgikgyaknlpdgsvevvaegyeealskller ikqgppaaevekvdesfseykgefedfety
Timeline for d4ojha_: