SCOPe 2.06: Domain d4ojha_: 4ojh A:

Lineage for d4ojha_ (4ojh A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families)

5. Family d.58.10.0: automated matches [191394] (1 protein)
   not a true family

6. Protein automated matches [190511] (7 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [187465] (8 PDB entries)

8. Domain d4ojha_: 4ojh A: [257275]
   automated match to d1y9oa_
   complexed with so4; mutant

Details for d4ojha_

PDB Entry: 4ojh, 1.6 Å

PDB Description: The crystal structure of truncated, Y86E mutant of S. solfataricus acylphosphatase

PDB Compounds: (A:) acylphosphatase

SCOPe Domain Sequences for d4ojha_:

Sequence; same for both SEQRES and ATOM records:

>d4ojha_ d.58.10.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
mlkrmyarvyglvqgvgfrkfvqihairlgikgyaknlpdgsvevvaegyeealskller
ikqgppaaevekvdesfseykgefedfety

Timeline for d4ojha_:

• d4ojha_ first appeared in SCOPe 2.04
  
• d4ojha_ appears in SCOPe 2.05
  
• d4ojha_ appears in SCOPe 2.07
  
• d4ojha_ appears in the current release, SCOPe 2.08