SCOP 1.73: Domain d1d8tb2: 1d8t B:297-393

Lineage for d1d8tb2 (1d8t B:297-393)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)

6. Protein Elongation factor Tu (EF-Tu) [50467] (4 species)

7. Species Escherichia coli [TaxId:562] [50468] (7 PDB entries)

8. Domain d1d8tb2: 1d8t B:297-393 [25727]
   Other proteins in same PDB: d1d8ta1, d1d8ta3, d1d8tb1, d1d8tb3
   complexed with ace, gdp, gea, mg

Details for d1d8tb2

PDB Entry: 1d8t, 2.35 Å

PDB Description: crystal structure of elongation factor, tu (ef-tu-mggdp) complexed with ge2270a, a thiazolyl peptide antibiotic

PDB Compounds: (B:) elongation factor tu

SCOP Domain Sequences for d1d8tb2:

Sequence; same for both SEQRES and ATOM records:

>d1d8tb2 b.44.1.1 (B:297-393) Elongation factor Tu (EF-Tu) {Escherichia coli [TaxId: 562]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvlg

Timeline for d1d8tb2:

• d1d8tb2 first appeared (with stable ids) in SCOP 1.55
  
• d1d8tb2 appears in SCOP 1.71
  
• d1d8tb2 appears in SCOP 1.75
  
• d1d8tb2 appears in the current release, SCOPe 2.08