Class b: All beta proteins [48724] (165 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins) |
Protein Elongation factor Tu (EF-Tu) [50467] (4 species) |
Species Escherichia coli [TaxId:562] [50468] (7 PDB entries) |
Domain d1d8tb2: 1d8t B:297-393 [25727] Other proteins in same PDB: d1d8ta1, d1d8ta3, d1d8tb1, d1d8tb3 complexed with ace, gdp, gea, mg |
PDB Entry: 1d8t (more details), 2.35 Å
SCOP Domain Sequences for d1d8tb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d8tb2 b.44.1.1 (B:297-393) Elongation factor Tu (EF-Tu) {Escherichia coli [TaxId: 562]} tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni kmvvtlihpiamddglrfaireggrtvgagvvakvlg
Timeline for d1d8tb2: