| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) ![]() the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
| Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins) 4 helices; irregular array |
| Protein automated matches [257263] (3 species) not a true protein |
| Species Thermus thermophilus [TaxId:300852] [257264] (3 PDB entries) |
| Domain d4oioe_: 4oio E: [257265] Other proteins in same PDB: d4oioc_, d4oiod_, d4oiof1, d4oiof2, d4oiof3 automated match to d1i6ve_ protein/DNA complex; protein/RNA complex; complexed with 2tm, atp, mg, zn |
PDB Entry: 4oio (more details), 3.1 Å
SCOPe Domain Sequences for d4oioe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oioe_ a.143.1.1 (E:) automated matches {Thermus thermophilus [TaxId: 300852]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnav
twamkelltgrlvfgenlvpedrlqkemerlypv
Timeline for d4oioe_: