Lineage for d4oioe_ (4oio E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734750Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 2734751Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 2734752Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins)
    4 helices; irregular array
  6. 2734793Protein automated matches [257263] (3 species)
    not a true protein
  7. 2734798Species Thermus thermophilus [TaxId:300852] [257264] (3 PDB entries)
  8. 2734799Domain d4oioe_: 4oio E: [257265]
    Other proteins in same PDB: d4oioc_, d4oiod_, d4oiof1, d4oiof2, d4oiof3
    automated match to d1i6ve_
    protein/DNA complex; protein/RNA complex; complexed with 2tm, atp, mg, zn

Details for d4oioe_

PDB Entry: 4oio (more details), 3.1 Å

PDB Description: Crystal structure of Thermus thermophilus pre-insertion substrate complex for de novo transcription initiation
PDB Compounds: (E:) DNA-directed RNA polymerase subunit omega

SCOPe Domain Sequences for d4oioe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oioe_ a.143.1.1 (E:) automated matches {Thermus thermophilus [TaxId: 300852]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnav
twamkelltgrlvfgenlvpedrlqkemerlypv

SCOPe Domain Coordinates for d4oioe_:

Click to download the PDB-style file with coordinates for d4oioe_.
(The format of our PDB-style files is described here.)

Timeline for d4oioe_: