SCOPe 2.03: Domain d1dg1h2: 1dg1 H:297-393

Lineage for d1dg1h2 (1dg1 H:297-393)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)

6. Protein Elongation factor Tu (EF-Tu) [50467] (4 species)

7. Species Escherichia coli [TaxId:562] [50468] (7 PDB entries)
   Uniprot P02990

8. Domain d1dg1h2: 1dg1 H:297-393 [25725]
   Other proteins in same PDB: d1dg1g1, d1dg1g3, d1dg1h1, d1dg1h3
   complexed with gdp, mg

Details for d1dg1h2

PDB Entry: 1dg1, 2.5 Å

PDB Description: whole, unmodified, ef-tu(elongation factor tu).

PDB Compounds: (H:) elongation factor tu

SCOPe Domain Sequences for d1dg1h2:

Sequence; same for both SEQRES and ATOM records:

>d1dg1h2 b.44.1.1 (H:297-393) Elongation factor Tu (EF-Tu) {Escherichia coli [TaxId: 562]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvls

Timeline for d1dg1h2:

• d1dg1h2 first appeared (with stable ids) in SCOP 1.55
  
• d1dg1h2 appears in SCOPe 2.02
  
• d1dg1h2 appears in SCOPe 2.04
  
• d1dg1h2 appears in the current release, SCOPe 2.08