Lineage for d1dg1h2 (1dg1 H:297-393)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60248Fold b.44: EF-Tu/eEF-1alpha C-terminal domain [50464] (1 superfamily)
  4. 60249Superfamily b.44.1: EF-Tu/eEF-1alpha C-terminal domain [50465] (1 family) (S)
  5. 60250Family b.44.1.1: EF-Tu/eEF-1alpha C-terminal domain [50466] (2 proteins)
  6. 60257Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 60263Species Escherichia coli [TaxId:562] [50468] (4 PDB entries)
  8. 60269Domain d1dg1h2: 1dg1 H:297-393 [25725]
    Other proteins in same PDB: d1dg1g1, d1dg1g3, d1dg1h1, d1dg1h3

Details for d1dg1h2

PDB Entry: 1dg1 (more details), 2.5 Å

PDB Description: whole, unmodified, ef-tu(elongation factor tu).

SCOP Domain Sequences for d1dg1h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dg1h2 b.44.1.1 (H:297-393) Elongation factor Tu (EF-Tu) {Escherichia coli}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvls

SCOP Domain Coordinates for d1dg1h2:

Click to download the PDB-style file with coordinates for d1dg1h2.
(The format of our PDB-style files is described here.)

Timeline for d1dg1h2: