SCOPe 2.05: Domain d4odda_: 4odd A:

Lineage for d4odda_ (4odd A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.0: automated matches [191454] (1 protein)
   not a true family

6. Protein automated matches [190698] (16 species)
   not a true protein

7. Species Canis lupus [TaxId:9615] [257248] (1 PDB entry)

8. Domain d4odda_: 4odd A: [257249]
   automated match to d1gt1a_

Details for d4odda_

PDB Entry: 4odd, 2.6 Å

PDB Description: Crystal structure of a dog lipocalin allergen

PDB Compounds: (A:) lipocalin allergen

SCOPe Domain Sequences for d4odda_:

Sequence; same for both SEQRES and ATOM records:

>d4odda_ b.60.1.0 (A:) automated matches {Canis lupus [TaxId: 9615]}
tqvsgpwktlyvssnnldkigengpfriylrginvdiprlkmlfnfyvkvdgecvensvg
asigrdnlikgeynggnyfriidmtpnaligydvnvdskgkitkvallmgrgahvneedi
akfkklsrekgipeeniiylgdtdncpnh

Timeline for d4odda_:

• d4odda_ first appeared in SCOPe 2.04
  
• d4odda_ appears in SCOPe 2.06
  
• d4odda_ appears in the current release, SCOPe 2.08