Lineage for d1dg1g2 (1dg1 G:297-393)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2793864Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793865Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2793866Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins)
  6. 2793894Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 2793901Species Escherichia coli [TaxId:562] [50468] (9 PDB entries)
    Uniprot P02990
  8. 2793904Domain d1dg1g2: 1dg1 G:297-393 [25724]
    Other proteins in same PDB: d1dg1g1, d1dg1g3, d1dg1h1, d1dg1h3
    complexed with gdp, mg

Details for d1dg1g2

PDB Entry: 1dg1 (more details), 2.5 Å

PDB Description: whole, unmodified, ef-tu(elongation factor tu).
PDB Compounds: (G:) elongation factor tu

SCOPe Domain Sequences for d1dg1g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dg1g2 b.44.1.1 (G:297-393) Elongation factor Tu (EF-Tu) {Escherichia coli [TaxId: 562]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvls

SCOPe Domain Coordinates for d1dg1g2:

Click to download the PDB-style file with coordinates for d1dg1g2.
(The format of our PDB-style files is described here.)

Timeline for d1dg1g2: