SCOPe 2.08: Domain d4o7da1: 4o7d A:221-531

Lineage for d4o7da1 (4o7d A:221-531)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255788] (12 PDB entries)

8. Domain d4o7da1: 4o7d A:221-531 [257235]
   Other proteins in same PDB: d4o7da2
   automated match to d3czda_
   complexed with onl

Details for d4o7da1

PDB Entry: 4o7d, 2.3 Å

PDB Description: Crystal structure of human glutaminase in complex DON

PDB Compounds: (A:) Glutaminase kidney isoform, mitochondrial

SCOPe Domain Sequences for d4o7da1:

Sequence; same for both SEQRES and ATOM records:

>d4o7da1 e.3.1.0 (A:221-531) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipdfmsftshidelyesakkqsggkvadyipqlakfspdlwgvsvctvdgqrhstgdtkv
pfclqscvkplkyaiavndlgteyvhryvgkepsglrfnklflneddkphnpmvnagaiv
vtslikqgvnnaekfdyvmqflnkmagneyvgfsnatfqseresgdrnfaigyylkekkc
fpegtdmvgildfyfqlcsievtcesasvmaatlanggfcpitgervlspeavrntlslm
hscgmydfsgqfafhvglpaksgvaggillvvpnvmgmmcwsppldkmgnsvkgihfchd
lvslcnfhnyd

Timeline for d4o7da1:

• d4o7da1 first appeared in SCOPe 2.04, called d4o7da_
  
• d4o7da1 appears in SCOPe 2.07