SCOPe 2.07: Domain d4o5sa_: 4o5s A:

Lineage for d4o5sa_ (4o5s A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (4 families)

5. Family b.68.6.1: SGL-like [63830] (4 proteins)

6. Protein automated matches [190602] (2 species)
   not a true protein

7. Species Squid (Loligo vulgaris) [TaxId:6622] [189000] (6 PDB entries)

8. Domain d4o5sa_: 4o5s A: [257231]
   automated match to d3i1ca_

Details for d4o5sa_

PDB Entry: 4o5s, 1.8 Å

PDB Description: crystal structure of diels-alderase ce11

PDB Compounds: (A:) Diisopropyl-fluorophosphatase

SCOPe Domain Sequences for d4o5sa_:

Sequence; same for both SEQRES and ATOM records:

>d4o5sa_ b.68.6.1 (A:) automated matches {Squid (Loligo vulgaris) [TaxId: 6622]}
eipvieplftkmtedipgatgpvfdkngdfyvvasplsealtkanspaeaykasrgagei
lhidlktgkktvickpevngyggspigcqcdrdanqlfvadmrlgllvvqtegtfeeiak
kdsegrcmqgcaycafdyegnlwitapaggvapadftislrekfgsiycfttdgqmiqvd
tafqcpagiavrhmndgrpyqlivaeqptkklwsydikgpanienkkvwghipgthkgga
agmvfdednnllvanwgsshievfgpdggqpkmrircpfekpanlhfkpqtktifvtehd
nnavwkfewqrngkkqycetskf

Timeline for d4o5sa_:

• d4o5sa_ first appeared in SCOPe 2.04
  
• d4o5sa_ appears in SCOPe 2.06
  
• d4o5sa_ appears in the current release, SCOPe 2.08