Lineage for d4o5sa_ (4o5s A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1553917Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1554505Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (3 families) (S)
  5. 1554506Family b.68.6.1: SGL-like [63830] (4 proteins)
  6. 1554537Protein automated matches [190602] (2 species)
    not a true protein
  7. 1554538Species Squid (Loligo vulgaris) [TaxId:6622] [189000] (6 PDB entries)
  8. 1554548Domain d4o5sa_: 4o5s A: [257231]
    automated match to d3i1ca_

Details for d4o5sa_

PDB Entry: 4o5s (more details), 1.8 Å

PDB Description: crystal structure of diels-alderase ce11
PDB Compounds: (A:) Diisopropyl-fluorophosphatase

SCOPe Domain Sequences for d4o5sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o5sa_ b.68.6.1 (A:) automated matches {Squid (Loligo vulgaris) [TaxId: 6622]}
eipvieplftkmtedipgatgpvfdkngdfyvvasplsealtkanspaeaykasrgagei
lhidlktgkktvickpevngyggspigcqcdrdanqlfvadmrlgllvvqtegtfeeiak
kdsegrcmqgcaycafdyegnlwitapaggvapadftislrekfgsiycfttdgqmiqvd
tafqcpagiavrhmndgrpyqlivaeqptkklwsydikgpanienkkvwghipgthkgga
agmvfdednnllvanwgsshievfgpdggqpkmrircpfekpanlhfkpqtktifvtehd
nnavwkfewqrngkkqycetskf

SCOPe Domain Coordinates for d4o5sa_:

Click to download the PDB-style file with coordinates for d4o5sa_.
(The format of our PDB-style files is described here.)

Timeline for d4o5sa_: