Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein Influenza hemagglutinin (stalk) [58066] (17 species) trimer |
Species Influenza A virus, different strains [TaxId:11320] [58067] (131 PDB entries) |
Domain d4o5nb_: 4o5n B: [257230] Other proteins in same PDB: d4o5na1, d4o5na2 automated match to d2viub_ complexed with gol, nag, peg |
PDB Entry: 4o5n (more details), 1.75 Å
SCOPe Domain Sequences for d4o5nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o5nb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} gifgaiagfiengwegmvdgwygfrhqnsegrgqaadlkstqaaidqingklnrligktn ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe ktkkqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdealnnrfqi
Timeline for d4o5nb_: