Lineage for d4o5nb_ (4o5n B:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645407Protein Influenza hemagglutinin (stalk) [58066] (17 species)
    trimer
  7. 2645520Species Influenza A virus, different strains [TaxId:11320] [58067] (131 PDB entries)
  8. 2645529Domain d4o5nb_: 4o5n B: [257230]
    Other proteins in same PDB: d4o5na1, d4o5na2
    automated match to d2viub_
    complexed with gol, nag, peg

Details for d4o5nb_

PDB Entry: 4o5n (more details), 1.75 Å

PDB Description: crystal structure of a/victoria/361/2011 (h3n2) influenza virus hemagglutinin
PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4o5nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o5nb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfiengwegmvdgwygfrhqnsegrgqaadlkstqaaidqingklnrligktn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktkkqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdealnnrfqi

SCOPe Domain Coordinates for d4o5nb_:

Click to download the PDB-style file with coordinates for d4o5nb_.
(The format of our PDB-style files is described here.)

Timeline for d4o5nb_: