![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) ![]() probably related to the second domain and its superfamiy by a circular permutation |
![]() | Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins) |
![]() | Protein Elongation factor Tu (EF-Tu) [50467] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [50468] (7 PDB entries) Uniprot P02990 |
![]() | Domain d1efuc2: 1efu C:297-393 [25723] Other proteins in same PDB: d1efua1, d1efua3, d1efub2, d1efub3, d1efub4, d1efuc1, d1efuc3, d1efud2, d1efud3, d1efud4 |
PDB Entry: 1efu (more details), 2.5 Å
SCOP Domain Sequences for d1efuc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efuc2 b.44.1.1 (C:297-393) Elongation factor Tu (EF-Tu) {Escherichia coli [TaxId: 562]} tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni kmvvtlihpiamddglrfaireggrtvgagvvakvls
Timeline for d1efuc2: