SCOPe 2.05: Domain d4o5na_: 4o5n A:

Lineage for d4o5na_ (4o5n A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (7 species)
   includes rudiment esterase domain

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (105 PDB entries)

8. Domain d4o5na_: 4o5n A: [257229]
   Other proteins in same PDB: d4o5nb_
   automated match to d3sdya_
   complexed with gol, nag, peg

Details for d4o5na_

PDB Entry: 4o5n, 1.75 Å

PDB Description: crystal structure of a/victoria/361/2011 (h3n2) influenza virus hemagglutinin

PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4o5na_:

Sequence; same for both SEQRES and ATOM records:

>d4o5na_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
pgatlclghhavpngtivktitndqievtnatelvqnssigeicdsphqildgenctlid
allgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfnwt
gvtqngtssacirrsnnsffsrlnwlthlnfkypalnvtmpnneqfdklyiwgvhhpgtd
kdqiflyaqssgritvstkrsqqavipnigsrprirnipsrisiywtivkpgdillinst
gnliaprgyfkirsgkssimrsdapigkcnsecitpngsipndkpfqnvnritygacpry
vkqstlklatgmrnvpe

Timeline for d4o5na_:

• d4o5na_ first appeared in SCOPe 2.04
  
• d4o5na_ is called d4o5na1 in SCOPe 2.06
  
• d4o5na_ appears in the current release, SCOPe 2.08, called d4o5na1