Lineage for d4o5na1 (4o5n A:11-325)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775631Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)
  8. 2775638Domain d4o5na1: 4o5n A:11-325 [257229]
    Other proteins in same PDB: d4o5na2, d4o5nb_
    automated match to d3sdya_
    complexed with gol, nag, peg

Details for d4o5na1

PDB Entry: 4o5n (more details), 1.75 Å

PDB Description: crystal structure of a/victoria/361/2011 (h3n2) influenza virus hemagglutinin
PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4o5na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o5na1 b.19.1.2 (A:11-325) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
atlclghhavpngtivktitndqievtnatelvqnssigeicdsphqildgenctlidal
lgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfnwtgv
tqngtssacirrsnnsffsrlnwlthlnfkypalnvtmpnneqfdklyiwgvhhpgtdkd
qiflyaqssgritvstkrsqqavipnigsrprirnipsrisiywtivkpgdillinstgn
liaprgyfkirsgkssimrsdapigkcnsecitpngsipndkpfqnvnritygacpryvk
qstlklatgmrnvpe

SCOPe Domain Coordinates for d4o5na1:

Click to download the PDB-style file with coordinates for d4o5na1.
(The format of our PDB-style files is described here.)

Timeline for d4o5na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4o5na2
View in 3D
Domains from other chains:
(mouse over for more information)
d4o5nb_