SCOPe 2.08: Domain d4o58l1: 4o58 L:1-107

Lineage for d4o58l1 (4o58 L:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4o58l1: 4o58 L:1-107 [257225]
   Other proteins in same PDB: d4o58a1, d4o58a2, d4o58b_, d4o58l2
   automated match to d2mcg11
   complexed with nag, peg, so4

Details for d4o58l1

PDB Entry: 4o58, 2.75 Å

PDB Description: crystal structure of broadly neutralizing antibody f045-092 in complex with a/victoria/3/1975 (h3n2) influenza hemagglutinin

PDB Compounds: (L:) Fab F045-092 light chain

SCOPe Domain Sequences for d4o58l1:

Sequence; same for both SEQRES and ATOM records:

>d4o58l1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsvltqppsasgtpgqsvtiscsgsrsniggntvnwyqhlpgmapklliyssnqrssgvp
drfsgsksgtsaslaisglqseddadyycaswddslngvvfgggtkltvlg

Timeline for d4o58l1:

• d4o58l1 first appeared in SCOPe 2.04
  
• d4o58l1 appears in SCOPe 2.07