Lineage for d4o58b_ (4o58 B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041252Domain d4o58b_: 4o58 B: [257224]
    Other proteins in same PDB: d4o58a1, d4o58a2, d4o58h_, d4o58l1, d4o58l2
    automated match to d2viub_
    complexed with nag, peg, so4

Details for d4o58b_

PDB Entry: 4o58 (more details), 2.75 Å

PDB Description: crystal structure of broadly neutralizing antibody f045-092 in complex with a/victoria/3/1975 (h3n2) influenza hemagglutinin
PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4o58b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o58b_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdealnnrfq

SCOPe Domain Coordinates for d4o58b_:

Click to download the PDB-style file with coordinates for d4o58b_.
(The format of our PDB-style files is described here.)

Timeline for d4o58b_: