![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein automated matches [190140] (37 species) not a true protein |
![]() | Species Escherichia coli [TaxId:536056] [255489] (2 PDB entries) |
![]() | Domain d4o4ba1: 4o4b A:1-366 [257222] Other proteins in same PDB: d4o4ba2 automated match to d1a7la_ |
PDB Entry: 4o4b (more details), 1.8 Å
SCOPe Domain Sequences for d4o4ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o4ba1 c.94.1.1 (A:1-366) automated matches {Escherichia coli [TaxId: 536056]} kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea lkdaqt
Timeline for d4o4ba1: