Lineage for d1efua2 (1efu A:297-393)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669876Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 669877Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 669878Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)
  6. 669906Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 669913Species Escherichia coli [TaxId:562] [50468] (7 PDB entries)
  8. 669920Domain d1efua2: 1efu A:297-393 [25722]
    Other proteins in same PDB: d1efua1, d1efua3, d1efub2, d1efub3, d1efub4, d1efuc1, d1efuc3, d1efud2, d1efud3, d1efud4

Details for d1efua2

PDB Entry: 1efu (more details), 2.5 Å

PDB Description: elongation factor complex ef-tu/ef-ts from escherichia coli
PDB Compounds: (A:) elongation factor tu

SCOP Domain Sequences for d1efua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efua2 b.44.1.1 (A:297-393) Elongation factor Tu (EF-Tu) {Escherichia coli [TaxId: 562]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvls

SCOP Domain Coordinates for d1efua2:

Click to download the PDB-style file with coordinates for d1efua2.
(The format of our PDB-style files is described here.)

Timeline for d1efua2: